PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_24080V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 479aa    MW: 52452.6 Da    PI: 6.9368
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_24080V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-171663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +l+ +v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Pp3c15_24080V3.3.p 16 KGPWTSAEDSILISYVTKHGEGNWNSVQKHSGLFRCGKSCRLRWANHL 63
                        79******************************************9986 PP

2Myb_DNA-binding51.42.4e-1669112146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE+  +v+++++lG++ W++ a+ ++ gRt++++k++w++
  Pp3c15_24080V3.3.p  69 KGAFTPEEERTIVELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 112
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2831163IPR017930Myb domain
SuperFamilySSF466891.72E-2914110IPR009057Homeodomain-like
SMARTSM007177.9E-141565IPR001005SANT/Myb domain
PfamPF002491.8E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231770IPR009057Homeodomain-like
CDDcd001678.98E-111863No hitNo description
PROSITE profilePS5129425.43164118IPR017930Myb domain
SMARTSM007171.3E-1568116IPR001005SANT/Myb domain
PfamPF002493.6E-1569112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2671118IPR009057Homeodomain-like
CDDcd001672.38E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MDLSSDIGQD GGSLKKGPWT SAEDSILISY VTKHGEGNWN SVQKHSGLFR CGKSCRLRWA  60
NHLRPNLKKG AFTPEEERTI VELHAKLGNK WARMAAQLPG RTDNEIKNYW NTRIKRRMRA  120
GLPVYPAEKA KSSPTQYYGK PSDGRSFISG EDADCDFISS FPQPGDHLHN LHAINECDHS  180
LTRNCLSMIP MGALAPSTTN QGTNQVLNKT IGNPFEQIEV FRNSHHGRSG IGNGNVSFAQ  240
LADGGNLNFQ TDFNSSSQGC DRGTTTRDVL PGFGNEPERN MMLYDRMSAY GNLNLLFKPP  300
VSNASLKLEL PSCQSAESAD SAGTQRSSIT NPSPLIPSTN ILSESESYGS NASNFLETLM  360
QDAHPTEGLG QVRFSMDIID QLMALTSGNT NPEVAALVLS PQKGRWGENS DPTTPLAGRT  420
FSDHSEEVSP MCPTGNLDDP EASTMPLLSQ YLYLPYYGYK SQTCPAKDRK KLRLPILI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32141185108B-MYB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.179500.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S66_200V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-70myb domain protein 33